Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002026-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002026-M01, RRID:AB_489725
- Product name
- ENO2 monoclonal antibody (M01), clone 1A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ENO2.
- Antigen sequence
PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKL
AQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIK
TGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFR
NPSVL- Isotype
- IgG
- Antibody clone number
- 1A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of alpha-enolase as an autoantigen in lung cancer: its overexpression is associated with clinical outcomes.
Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY
Clinical cancer research : an official journal of the American Association for Cancer Research 2006 Oct 1;12(19):5746-54
Clinical cancer research : an official journal of the American Association for Cancer Research 2006 Oct 1;12(19):5746-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in different cell lines.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3.Lane 1: ENO2 transfected lysate(47.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ENO2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol