Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006667-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006667-M02, RRID:AB_607082
- Product name
- SP1 monoclonal antibody (M02), clone 1A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SP1.
- Antigen sequence
GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQ
SGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQ
QVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATG
AQVQQ- Isotype
- IgG
- Antibody clone number
- 1A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SP1 monoclonal antibody (M02), clone 1A5. Western Blot analysis of SP1 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SP1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol