Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005294-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005294-M02, RRID:AB_733237
- Product name
- PIK3CG monoclonal antibody (M02), clone 2G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PIK3CG.
- Antigen sequence
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSM
ELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQM
KAQVWLRALETSVAADFYHRLGPHHFLLLY- Isotype
- IgG
- Antibody clone number
- 2G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PIK3CG is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PIK3CG on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between KIT and PIK3CG. HeLa cells were stained with anti-KIT rabbit purified polyclonal 1:1200 and anti-PIK3CG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
