Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005562-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005562-M03, RRID:AB_804903
- Product name
- PRKAA1 monoclonal antibody (M03), clone 4D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PRKAA1.
- Antigen sequence
LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRS
GSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLD
SSPVDLTPRPGSHTIEFFEMCANLIKILAQ- Isotype
- IgG
- Antibody clone number
- 4D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRKAA1 monoclonal antibody (M03), clone 4D8 Western Blot analysis of PRKAA1 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PRKAA1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PRKAA1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol