Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006662-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006662-M04, RRID:AB_875841
- Product name
- SOX9 monoclonal antibody (M04), clone 3F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SOX9.
- Antigen sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPP
ITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYM
NPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYT
QLTRP- Isotype
- IgG
- Antibody clone number
- 3F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pathological characteristics of intraductal polypoid neoplasms of bile ducts in Thailand.
Nitta T, Nakanuma Y, Sato Y, Hirano S, Pairojkul C
International journal of clinical and experimental pathology 2015;8(7):8284-90
International journal of clinical and experimental pathology 2015;8(7):8284-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SOX9 monoclonal antibody (M04), clone 3F11 Western Blot analysis of SOX9 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol