Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055359-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055359-M03, RRID:AB_894297
- Product name
- STYK1 monoclonal antibody (M03), clone 4A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STYK1.
- Antigen sequence
REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVA
LPLKETSVENFLGATTPALAKLQVPREQLSEVLEQ
ICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAG
LHEVQ- Isotype
- IgG
- Antibody clone number
- 4A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STYK1 monoclonal antibody (M03), clone 4A4 Western Blot analysis of STYK1 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STYK1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol