Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002597-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002597-M01, RRID:AB_565775
- Product name
- GAPDH monoclonal antibody (M01), clone 3C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GAPDH.
- Antigen sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKK
VVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTF
DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAH
MASKE- Isotype
- IgG
- Antibody clone number
- 3C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Radioprotective effects of genistein on HL-7702 cells via the inhibition of apoptosis and DNA damage.
Supplementation of strontium to a chondrogenic medium promotes chondrogenic differentiation of human dedifferentiated fat cells.
miR-106b is overexpressed in medulloblastomas and interacts directly with PTEN.
Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.
RacGTPase-activating protein 1 interacts with hepatitis C virus polymerase NS5B to regulate viral replication.
Receptor for activated protein kinase C: requirement for efficient microRNA function and reduced expression in hepatocellular carcinoma.
Expression and roles of Slit/Robo in human ovarian cancer.
Anti-angiogenic effect of triterpenoidal saponins from Polygala senega.
The effect of allelic variation in aldo-keto reductase 1C2 on the in vitro metabolism of dihydrotestosterone.
Song L, Ma L, Cong F, Shen X, Jing P, Ying X, Zhou H, Jiang J, Fu Y, Yan H
Cancer letters 2015 Sep 28;366(1):100-11
Cancer letters 2015 Sep 28;366(1):100-11
Supplementation of strontium to a chondrogenic medium promotes chondrogenic differentiation of human dedifferentiated fat cells.
Okita N, Honda Y, Kishimoto N, Liao W, Azumi E, Hashimoto Y, Matsumoto N
Tissue engineering. Part A 2015 May;21(9-10):1695-704
Tissue engineering. Part A 2015 May;21(9-10):1695-704
miR-106b is overexpressed in medulloblastomas and interacts directly with PTEN.
Li KK, Xia T, Ma FM, Zhang R, Mao Y, Wang Y, Zhou L, Lau KM, Ng HK
Neuropathology and applied neurobiology 2015 Feb;41(2):145-64
Neuropathology and applied neurobiology 2015 Feb;41(2):145-64
Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.
Wu MJ, Ke PY, Hsu JT, Yeh CT, Horng JT
Cellular microbiology 2014 Nov;16(11):1603-18
Cellular microbiology 2014 Nov;16(11):1603-18
RacGTPase-activating protein 1 interacts with hepatitis C virus polymerase NS5B to regulate viral replication.
Wu MJ, Ke PY, Horng JT
Biochemical and biophysical research communications 2014 Nov 7;454(1):19-24
Biochemical and biophysical research communications 2014 Nov 7;454(1):19-24
Receptor for activated protein kinase C: requirement for efficient microRNA function and reduced expression in hepatocellular carcinoma.
Otsuka M, Takata A, Yoshikawa T, Kojima K, Kishikawa T, Shibata C, Takekawa M, Yoshida H, Omata M, Koike K
PloS one 2011;6(9):e24359
PloS one 2011;6(9):e24359
Expression and roles of Slit/Robo in human ovarian cancer.
Dai CF, Jiang YZ, Li Y, Wang K, Liu PS, Patankar MS, Zheng J
Histochemistry and cell biology 2011 May;135(5):475-85
Histochemistry and cell biology 2011 May;135(5):475-85
Anti-angiogenic effect of triterpenoidal saponins from Polygala senega.
Arai M, Hayashi A, Sobou M, Ishida S, Kawachi T, Kotoku N, Kobayashi M
Journal of natural medicines 2011 Jan;65(1):149-56
Journal of natural medicines 2011 Jan;65(1):149-56
The effect of allelic variation in aldo-keto reductase 1C2 on the in vitro metabolism of dihydrotestosterone.
Takahashi RH, Grigliatti TA, Reid RE, Riggs KW
The Journal of pharmacology and experimental therapeutics 2009 Jun;329(3):1032-9
The Journal of pharmacology and experimental therapeutics 2009 Jun;329(3):1032-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in Raw 264.7(Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01), clone 3C2.Lane 1: GAPDH transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GAPDH is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol