Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002597-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002597-M01A, RRID:AB_1237714
- Product name
- GAPDH monoclonal antibody (M01A), clone 3C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GAPDH.
- Antigen sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKK
VVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTF
DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAH
MASKE- Isotype
- IgG
- Antibody clone number
- 3C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GAPDH monoclonal antibody (M01A), clone 3C2 Western Blot analysis of GAPDH expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01A), clone 3C2.Lane 1: GAPDH transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.