Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000915-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000915-D01P, RRID:AB_1673172
- Product name
- CD3D purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CD3D protein.
- Antigen sequence
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFV
NCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGI
YRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
GIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQ
ALLRNDQVYQPLRDRDDAQYSHLGGNWARNK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CD3D expression in transfected 293T cell line (H00000915-T01) by CD3D MaxPab polyclonal antibody.Lane 1: CD3D transfected lysate(18.90 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CD3D MaxPab rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CD3D and CANX. HeLa cells were stained with anti-CD3D rabbit purified polyclonal 1:1200 and anti-CANX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)