Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405991 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Adenylosuccinate Synthase Like 1 (ADSSL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ADSSL1 antibody: synthetic peptide directed towards the middle region of human ADSSL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAART
GLRIC DLLSDFDEFS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular cloning and characterization of a novel muscle adenylosuccinate synthetase, AdSSL1, from human bone marrow stromal cells.
Sun H, Li N, Wang X, Chen T, Shi L, Zhang L, Wang J, Wan T, Cao X
Molecular and cellular biochemistry 2005 Jan;269(1-2):85-94
Molecular and cellular biochemistry 2005 Jan;269(1-2):85-94
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting