Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503923 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRP
LSDIS SQTQSIYIPR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Physical interaction between aldolase and vacuolar H+-ATPase is essential for the assembly and activity of the proton pump.
Lu M, Ammar D, Ives H, Albrecht F, Gluck SL
The Journal of biological chemistry 2007 Aug 24;282(34):24495-503
The Journal of biological chemistry 2007 Aug 24;282(34):24495-503
No comments: Submit comment
No validations: Submit validation data