Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503487 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Aurora Kinase C (AURKC) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AURKC antibody: synthetic peptide directed towards the middle region of human AURKC
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYR
RILKV DVRFPLSMPL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The protein kinase Aurora C phosphorylates TRF2.
Nuclear translocation of CAM-associated protein activates transcription for long-term facilitation in Aplysia.
Spengler D
Cell cycle (Georgetown, Tex.) 2007 Oct 15;6(20):2579-80
Cell cycle (Georgetown, Tex.) 2007 Oct 15;6(20):2579-80
Nuclear translocation of CAM-associated protein activates transcription for long-term facilitation in Aplysia.
Lee SH, Lim CS, Park H, Lee JA, Han JH, Kim H, Cheang YH, Lee SH, Lee YS, Ko HG, Jang DH, Kim H, Miniaci MC, Bartsch D, Kim E, Bailey CH, Kandel ER, Kaang BK
Cell 2007 May 18;129(4):801-12
Cell 2007 May 18;129(4):801-12
No comments: Submit comment
No validations: Submit validation data