Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182612 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Homeodomain Interacting Protein Kinase 2 (HIPK2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-HIPK2 antibody is: synthetic peptide directed towards the middle region of Human HIPK2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQG
LPAEY LLSAGTKTTR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references v-Myc inhibits C/EBPbeta activity by preventing C/EBPbeta-induced phosphorylation of the co-activator p300.
Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1.
Steinmann S, Schulte K, Beck K, Chachra S, Bujnicki T, Klempnauer KH
Oncogene 2009 Jul 2;28(26):2446-55
Oncogene 2009 Jul 2;28(26):2446-55
Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1.
Choi DW, Seo YM, Kim EA, Sung KS, Ahn JW, Park SJ, Lee SR, Choi CY
The Journal of biological chemistry 2008 Feb 22;283(8):4682-9
The Journal of biological chemistry 2008 Feb 22;283(8):4682-9
No comments: Submit comment
No validations: Submit validation data