Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311594 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-ADAM Metallopeptidase Domain 2 (ADAM2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ADAM2 antibody: synthetic peptide directed towards the middle region of human ADAM2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVV
LHPRT ISLESLAVIL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Functional classification of ADAMs based on a conserved motif for binding to integrin alpha 9beta 1: implications for sperm-egg binding and other cell interactions.
Eto K, Huet C, Tarui T, Kupriyanov S, Liu HZ, Puzon-McLaughlin W, Zhang XP, Sheppard D, Engvall E, Takada Y
The Journal of biological chemistry 2002 May 17;277(20):17804-10
The Journal of biological chemistry 2002 May 17;277(20):17804-10
No comments: Submit comment
No validations: Submit validation data