Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309861 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Neuronal PAS Domain Protein 2 (NPAS2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NPAS2 antibody: synthetic peptide directed towards the N terminal of human NPAS2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSM
LPGNT RKMDKTTVLE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Non-synonymous polymorphisms in the circadian gene NPAS2 and breast cancer risk.
Zhu Y, Stevens RG, Leaderer D, Hoffman A, Holford T, Zhang Y, Brown HN, Zheng T
Breast cancer research and treatment 2008 Feb;107(3):421-5
Breast cancer research and treatment 2008 Feb;107(3):421-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting