Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309692 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the N terminal of human MRPS15
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKV
DDVVK RLLSLEMANK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Pentatricopeptide repeat domain protein 3 associates with the mitochondrial small ribosomal subunit and regulates translation.
Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
Davies SM, Rackham O, Shearwood AM, Hamilton KL, Narsai R, Whelan J, Filipovska A
FEBS letters 2009 Jun 18;583(12):1853-8
FEBS letters 2009 Jun 18;583(12):1853-8
Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
Zhang Z, Gerstein M
Genomics 2003 May;81(5):468-80
Genomics 2003 May;81(5):468-80
No comments: Submit comment
No validations: Submit validation data