Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002969 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002969, RRID:AB_1079870
- Product name
- Anti-SKAP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCR
PTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEE
DESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRG
DL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Oncogenomic analysis of mycosis fungoides reveals major differences with Sezary syndrome
van Doorn R, van Kester M, Dijkman R, Vermeer M, Mulder A, Szuhai K, Knijnenburg J, Boer J, Willemze R, Tensen C
Blood 2009 January;113(1):127-136
Blood 2009 January;113(1):127-136
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to nucleoplasm, plasma membrane & cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-SKAP1 antibody. Corresponding SKAP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN