ABIN632602

antibody from antibodies-online

Targeting: PPP4R3A FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632602 - Provider product page
Provider: antibodies-online
Product name: anti-Serine/threonine-Protein Phosphatase 4 Regulatory Subunit 3A (SMEK1) antibody
Antibody type: Polyclonal
Antigen: SMEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PPP4R3A protein structure - ABIN632602 shown in red.