ABIN636070

antibody from antibodies-online

Targeting: CYP2D6 CPD6, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, P450-DB1, P450C2D

Western blot

Antibody data

Submit

Validation data

Product number: ABIN636070 - Provider product page
Provider: antibodies-online
Product name: anti-Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: CYP2 D6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
Description: Affinity purified
Reactivity: Human, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CYP2D6 protein structure - ABIN636070 shown in red.