ABIN631100

antibody from antibodies-online

Targeting: LACTB FLJ14902, MRPL56

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631100 - Provider product page
Provider: antibodies-online
Product name: anti-Lactamase, beta (LACTB) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

LACTB protein structure - ABIN631100 shown in red.