HPA016649

antibody from Atlas Antibodies

Targeting: ARFGAP2 FLJ14576, IRZ, Zfp289, ZNF289

Antibody data

Submit

Validation data

Product number: HPA016649 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA016649, RRID:AB_1844980
Product name: Anti-ARFGAP2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPAT EPSGTQQPAPSTESSGLAQPEHGPNTDLLGTSPKA SLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ARFGAP2 protein structure - HPA016649 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-ARFGAP2 antibody HPA016649 (A) shows similar protein distribution across tissues to independent antibody HPA018152 (B).
Antibody #2 product nr: HPA018152
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human appendix shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ARFGAP2 antibody HPA016649.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ARFGAP2 antibody HPA016649.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ARFGAP2 antibody HPA016649.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-ARFGAP2 antibody HPA016649.
Sample type: HUMAN