HPA021479

antibody from Atlas Antibodies

Targeting: HSD17B4 DBP, MFE-2, SDR8C1

Antibody data

Submit

Validation data

Product number: HPA021479 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021479, RRID:AB_1844352
Product name: Anti-HSD17B4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVT RAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSA AKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMT QTVMPEDLVEALKPEYVAPLV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HSD17B4 protein structure - HPA021479 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and pancreas tissues using Anti-HSD17B4 antibody. Corresponding HSD17B4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human liver, lung, lymph node and testis using Anti-HSD17B4 antibody HPA021479 (A) shows similar protein distribution across tissues to independent antibody HPA021302 (B).
Antibody #2 product nr: HPA021302, HPA021311
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-HSD17B4 antibody HPA021479.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-HSD17B4 antibody HPA021479.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung using Anti-HSD17B4 antibody HPA021479.
Sample type: HUMAN