Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449807 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 92 (ZNF92) (Isoform 2), (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the C-terminal region of human ZNF92 (isoform 2, Q03936-2)
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
KPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHEC
GRAFNKSSNYTKEKL- Epitope
- Isoform 2,C-Term
- Vial size
- 0.1 mg
- Concentration
- 1.0 mg/mL
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.
Bellefroid EJ, Marine JC, Ried T, Lecocq PJ, Rivière M, Amemiya C, Poncelet DA, Coulie PG, de Jong P, Szpirer C
The EMBO journal 1993 Apr;12(4):1363-74
The EMBO journal 1993 Apr;12(4):1363-74
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-ZNF92 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate; ZNF92 antibody - C-terminal region (AP42492PU-N) in Human Jurkat cells using Western Blot