Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [3]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004314-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004314-M02, RRID:AB_1137311
- Product name
- MMP3 monoclonal antibody (M02), clone 4C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MMP3.
- Antigen sequence
GAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKD
SGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPR
CGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLP
KDAVD- Isotype
- IgG
- Antibody clone number
- 4C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MMP3 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MMP3 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MMP3 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of MMP3 transfected lysate using anti-MMP3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MMP3 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
