Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502207 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPN
AKKVT HTLKSNSWLN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references No role of matrixmetalloproteinase-3 genetic promoter polymorphism 1171 as a risk factor for cirrhosis in alcoholic liver disease.
Stickel F, Osterreicher CH, Halangk J, Berg T, Homann N, Hellerbrand C, Patsenker E, Schneider V, Kolb A, Friess H, Schuppan D, Puhl G, Seitz HK, Leathart JL, Day CP
Alcoholism, clinical and experimental research 2008 Jun;32(6):959-65
Alcoholism, clinical and experimental research 2008 Jun;32(6):959-65
No comments: Submit comment
No validations: Submit validation data