ABIN310072
antibody from antibodies-online
Targeting: PRPF6
ANT-1, bB152O15.1, C20orf14, hPrp6, Prp6, RP60, SNRNP102, TOM, U5-102K
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310072 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PRP6 Pre-MRNA Processing Factor 6 Homolog (S. Cerevisiae) (PRPF6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRPF6 antibody: synthetic peptide directed towards the N terminal of human PRPF6
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYA
GSLFS SGPYEKDDEE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of the functional domains of ANT-1, a novel coactivator of the androgen receptor.
Fan S, Goto K, Chen G, Morinaga H, Nomura M, Okabe T, Nawata H, Yanase T
Biochemical and biophysical research communications 2006 Mar 3;341(1):192-201
Biochemical and biophysical research communications 2006 Mar 3;341(1):192-201
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting