Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184283 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Elongation Factor B (SIII), Polypeptide 3 (110kDa, Elongin A) (TCEB3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TCEB3 antibody: synthetic peptide directed towards the C terminal of human TCEB3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPM
MAKTI KAFKNRFSRR- Vial size
- 100 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Large-scale characterization of HeLa cell nuclear phosphoproteins.
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villén J, Li J, Cohn MA, Cantley LC, Gygi SP
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
No comments: Submit comment
No validations: Submit validation data