Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310878 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Torsin Family 1, Member B (Torsin B) (TOR1B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TOR1B antibody: synthetic peptide directed towards the C terminal of human TOR1B
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVK
MCVRA EMRARGSAID- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The TOR1A (DYT1) gene family and its role in early onset torsion dystonia.
Ozelius LJ, Page CE, Klein C, Hewett JW, Mineta M, Leung J, Shalish C, Bressman SB, de Leon D, Brin MF, Fahn S, Corey DP, Breakefield XO
Genomics 1999 Dec 15;62(3):377-84
Genomics 1999 Dec 15;62(3):377-84
No comments: Submit comment
No validations: Submit validation data