Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310270 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MMP1 antibody: synthetic peptide directed towards the N terminal of human MMP1
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRR
NSGPV VEKLKQMQEF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references C-reactive protein induces matrix metalloproteinase-1 and -10 in human endothelial cells: implications for clinical and subclinical atherosclerosis.
Montero I, Orbe J, Varo N, Beloqui O, Monreal JI, Rodríguez JA, Díez J, Libby P, Páramo JA
Journal of the American College of Cardiology 2006 Apr 4;47(7):1369-78
Journal of the American College of Cardiology 2006 Apr 4;47(7):1369-78
No comments: Submit comment
No validations: Submit validation data