Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024574 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024574, RRID:AB_1854715
- Product name
- Anti-NUP205
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKN
LRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLL
MEEISTVLQYVVGRNKLLQCLHAKRHALES- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Critical Function for Nuclear Envelope Protein TMEM209 in Human Pulmonary Carcinogenesis
Fujitomo T, Daigo Y, Matsuda K, Ueda K, Nakamura Y
Cancer Research 2012 August;72(16):4110-4118
Cancer Research 2012 August;72(16):4110-4118
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-NUP205 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HEK 293.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra and a subset of reaction center cells.
- Sample type
- HUMAN
