Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311732 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, theta Polypeptide (YWHAQ) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLI
KDYRE KVESELRSIC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CPAP interacts with 14-3-3 in a cell cycle-dependent manner.
Accelerated intervertebral disc degeneration in scoliosis versus physiological ageing develops against a background of enhanced anabolic gene expression.
Chen CY, Olayioye MA, Lindeman GJ, Tang TK
Biochemical and biophysical research communications 2006 Apr 21;342(4):1203-10
Biochemical and biophysical research communications 2006 Apr 21;342(4):1203-10
Accelerated intervertebral disc degeneration in scoliosis versus physiological ageing develops against a background of enhanced anabolic gene expression.
Bertram H, Steck E, Zimmerman G, Chen B, Carstens C, Nerlich A, Richter W
Biochemical and biophysical research communications 2006 Apr 14;342(3):963-72
Biochemical and biophysical research communications 2006 Apr 14;342(3):963-72
No comments: Submit comment
No validations: Submit validation data