Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055031-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055031-M01, RRID:AB_490053
- Product name
- USP47 monoclonal antibody (M01), clone 5F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant USP47.
- Antigen sequence
TEQADLINELYQGKLKDYVRCLECGYEGWRIDTYL
DIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPN
QYFCERCKKKCDARKGLRFLHFPYLLTLQ- Isotype
- IgG
- Antibody clone number
- 5F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references USP47 and C terminus of Hsp70-interacting protein (CHIP) antagonistically regulate katanin-p60-mediated axonal growth.
The ubiquitin-specific protease USP47 is a novel beta-TRCP interactor regulating cell survival.
Yang SW, Oh KH, Park E, Chang HM, Park JM, Seong MW, Ka SH, Song WK, Park DE, Baas PW, Jeon YJ, Chung CH
The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Jul 31;33(31):12728-38
The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Jul 31;33(31):12728-38
The ubiquitin-specific protease USP47 is a novel beta-TRCP interactor regulating cell survival.
Peschiaroli A, Skaar JR, Pagano M, Melino G
Oncogene 2010 Mar 4;29(9):1384-93
Oncogene 2010 Mar 4;29(9):1384-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- USP47 monoclonal antibody (M01), clone 5F9 Western Blot analysis of USP47 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged USP47 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to USP47 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol