HPA015007

antibody from Atlas Antibodies

Targeting: PNMA1 MA1

Antibody data

Submit

Validation data

Product number: HPA015007 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015007, RRID:AB_1855502
Product name: Anti-PNMA1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RLMESLRGPAADVIRILKSNNPAITTAECLKALEQ VFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEP LLQKVVEKGAIDKDNVNQARLEQVIAGANHSGAIR RQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEA EATLLQLGL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PNMA1 protein structure - HPA015007 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-PNMA1 antibody. Corresponding PNMA1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, hippocampus and testis using Anti-PNMA1 antibody HPA015007 (A) shows similar protein distribution across tissues to independent antibody HPA003817 (B).
Antibody #2 product nr: HPA003817
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PNMA1 antibody HPA015007.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PNMA1 antibody HPA015007.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus using Anti-PNMA1 antibody HPA015007.
Sample type: HUMAN