ABIN632439

antibody from antibodies-online

Targeting: ATAT1 C6orf134, Em:AB023049.7, FLJ13158, MEC17

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632439 - Provider product page
Provider: antibodies-online
Product name: anti-Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: C6 ORF134 antibody was raised using the middle region of C6 rf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ATAT1 protein structure - ABIN632439 shown in red.