Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502909 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-phosphoglycerate Mutase 2 (Muscle) (PGAM2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PGAM2 antibody: synthetic peptide directed towards the middle region of human PGAM2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
EQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAG
LKPGE LPTCESLKDT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Manifesting heterozygotes in a Japanese family with a novel mutation in the muscle-specific phosphoglycerate mutase (PGAM-M) gene.
Hadjigeorgiou GM, Kawashima N, Bruno C, Andreu AL, Sue CM, Rigden DJ, Kawashima A, Shanske S, DiMauro S
Neuromuscular disorders : NMD 1999 Oct;9(6-7):399-402
Neuromuscular disorders : NMD 1999 Oct;9(6-7):399-402
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting