Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00151648-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00151648-M01, RRID:AB_426139
- Product name
- SGOL1 monoclonal antibody (M01), clone 3C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SGOL1.
- Antigen sequence
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGK
RRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN
EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTS
QQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ
IPLEETELPGQGESFQIEATPPETQQSPHLSLKDI
TNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCT
ASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKK
DLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDC
RKCKLETHICLR- Isotype
- IgG
- Antibody clone number
- 3C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Negative feedback at kinetochores underlies a responsive spindle checkpoint signal.
Dynamics of cohesin proteins REC8, STAG3, SMC1 beta and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes.
Centromere DNA decatenation depends on cohesin removal and is required for mammalian cell division.
Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
A B56gamma mutation in lung cancer disrupts the p53-dependent tumor-suppressor function of protein phosphatase 2A.
Visualizing histone modifications in living cells: spatiotemporal dynamics of H3 phosphorylation during interphase.
Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis.
Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity.
Regulation of mitotic chromosome cohesion by Haspin and Aurora B.
Nijenhuis W, Vallardi G, Teixeira A, Kops GJ, Saurin AT
Nature cell biology 2014 Dec;16(12):1257-64
Nature cell biology 2014 Dec;16(12):1257-64
Dynamics of cohesin proteins REC8, STAG3, SMC1 beta and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes.
Garcia-Cruz R, Brieño MA, Roig I, Grossmann M, Velilla E, Pujol A, Cabero L, Pessarrodona A, Barbero JL, Garcia Caldés M
Human reproduction (Oxford, England) 2010 Sep;25(9):2316-27
Human reproduction (Oxford, England) 2010 Sep;25(9):2316-27
Centromere DNA decatenation depends on cohesin removal and is required for mammalian cell division.
Wang LH, Mayer B, Stemmann O, Nigg EA
Journal of cell science 2010 Mar 1;123(Pt 5):806-13
Journal of cell science 2010 Mar 1;123(Pt 5):806-13
Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
Nozawa RS, Nagao K, Masuda HT, Iwasaki O, Hirota T, Nozaki N, Kimura H, Obuse C
Nature cell biology 2010 Jul;12(7):719-27
Nature cell biology 2010 Jul;12(7):719-27
A B56gamma mutation in lung cancer disrupts the p53-dependent tumor-suppressor function of protein phosphatase 2A.
Shouse GP, Nobumori Y, Liu X
Oncogene 2010 Jul 8;29(27):3933-41
Oncogene 2010 Jul 8;29(27):3933-41
Visualizing histone modifications in living cells: spatiotemporal dynamics of H3 phosphorylation during interphase.
Hayashi-Takanaka Y, Yamagata K, Nozaki N, Kimura H
The Journal of cell biology 2009 Dec 14;187(6):781-90
The Journal of cell biology 2009 Dec 14;187(6):781-90
Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis.
Fu G, Ding X, Yuan K, Aikhionbare F, Yao J, Cai X, Jiang K, Yao X
Cell research 2007 Jul;17(7):608-18
Cell research 2007 Jul;17(7):608-18
Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity.
Thein KH, Kleylein-Sohn J, Nigg EA, Gruneberg U
The Journal of cell biology 2007 Jul 30;178(3):345-54
The Journal of cell biology 2007 Jul 30;178(3):345-54
Regulation of mitotic chromosome cohesion by Haspin and Aurora B.
Dai J, Sullivan BA, Higgins JM
Developmental cell 2006 Nov;11(5):741-50
Developmental cell 2006 Nov;11(5):741-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01), clone 3C11.Lane 1: SGOL1 transfected lysate(33.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SGOL1 monoclonal antibody (M01), clone 3C11. Western Blot analysis of SGOL1 expression in PC-12.