Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001813-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001813-M01, RRID:AB_464253
- Product name
- DRD2 monoclonal antibody (M01), clone 1B11
- Antibody type
- Monoclonal
- Antigen
- DRD2 (AAH21195, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYN
YYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTN
YLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI
HCDIF- Isotype
- IgG
- Vial size
- 50 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Selective deposition and self-assembly of triblock copolymers into matrix arrays for membrane protein production.
Andreasson-Ochsner M, Fu Z, May S, Xiu LY, Nallani M, Sinner EK
Langmuir : the ACS journal of surfaces and colloids 2012 Jan 31;28(4):2044-8
Langmuir : the ACS journal of surfaces and colloids 2012 Jan 31;28(4):2044-8
No comments: Submit comment
No validations: Submit validation data