Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017856 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017856, RRID:AB_1847420
- Product name
- Anti-AS3MT
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKV
LWGECLGGALYWKELAVLAQKIGFCPPRLVTANLI
TIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRC
QVIYNGGITGHEKELMFDANFTFKEGEIVEVDEET
AAILK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human parathyroid gland and colon tissues using HPA017856 antibody. Corresponding AS3MT RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows weak cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows no cytoplasmic positivity in glandular cells as expected.
- Sample type
- HUMAN