Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487201 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Activin Receptor Type I (ACRV1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACVR1 antibody: synthetic peptide directed towards the N terminal of human ACVR1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQ
VYEQG KMTCKTPPSP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Basal expression of bone morphogenetic protein receptor is reduced in mild asthma.
Kariyawasam HH, Xanthou G, Barkans J, Aizen M, Kay AB, Robinson DS
American journal of respiratory and critical care medicine 2008 May 15;177(10):1074-81
American journal of respiratory and critical care medicine 2008 May 15;177(10):1074-81
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: ACVR1 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 μg/mL