HPA038316

antibody from Atlas Antibodies

Targeting: EIF3A EIF3, eIF3-p170, eIF3-theta, EIF3S10, KIAA0139, TIF32

Antibody data

Submit

Validation data

Product number: HPA038316 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038316, RRID:AB_10673168
Product name: Anti-EIF3A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PENALKRANEFLEVGKKQPALDVLYDVMKSKKHRT WQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNI CQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EIF3A protein structure - HPA038316 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-EIF3A antibody HPA038316 (A) shows similar protein distribution across tissues to independent antibody HPA038315 (B).
Antibody #2 product nr: HPA038315
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-EIF3A antibody HPA038316.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-EIF3A antibody HPA038316.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-EIF3A antibody HPA038316.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-EIF3A antibody HPA038316.
Sample type: HUMAN