Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183631 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Suppressor of Ty 6 Homolog (S. Cerevisiae) (SUPT6H) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SUPT6H antibody: synthetic peptide directed towards the N terminal of human SUPT6H
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
EAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEE
ENLDD QDEQGNLKGF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human Spt6 stimulates transcription elongation by RNA polymerase II in vitro.
Endoh M, Zhu W, Hasegawa J, Watanabe H, Kim DK, Aida M, Inukai N, Narita T, Yamada T, Furuya A, Sato H, Yamaguchi Y, Mandal SS, Reinberg D, Wada T, Handa H
Molecular and cellular biology 2004 Apr;24(8):3324-36
Molecular and cellular biology 2004 Apr;24(8):3324-36
No comments: Submit comment
No validations: Submit validation data