HPA019674

antibody from Atlas Antibodies

Targeting: NPAS2 bHLHe9, MOP4, PASD4

Antibody data

Submit

Validation data

Product number: HPA019674 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019674, RRID:AB_10601275
Product name: Anti-NPAS2
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEA LHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSP SASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALP RSATLPQELPVP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NPAS2 protein structure - HPA019674 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA019674 antibody. Corresponding NPAS2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse somatosensory cortex shows nuclear immunoreactivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows nuclear positivity.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse hippocampus shows nuclear positivity in the CA3/CA2 neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse periaqueductal grey shows nuclear immunoreactivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse midbrain shows strong positivity in locus coeruleus neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse pons shows nuclear positivity in the neurons of dorsal motor nucleus of vagus.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate positivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows nuclear positivity in Purkinje cells and in the molecular layer neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows weak nuclear positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse brain shows moderate positivity of neurons in the cerebral cortex.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse brain shows positivity in purkinje cells in the cerebellum.
Sample type: MOUSE