Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000570 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000570, RRID:AB_1079534
- Product name
- Anti-OTC
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK
GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLG
GHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA
R- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomics in free-living Mus spretus to monitor terrestrial ecosystems.
Montes-Nieto R, Fuentes-Almagro CA, Bonilla-Valverde D, Prieto-Alamo MJ, Jurado J, Carrascal M, Gómez-Ariza JL, López-Barea J, Pueyo C
Proteomics 2007 Dec;7(23):4376-87
Proteomics 2007 Dec;7(23):4376-87
No comments: Submit comment
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and kidney tissues using Anti-OTC antibody. Corresponding OTC RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, duodenum, liver and testis using Anti-OTC antibody HPA000570 (A) shows similar protein distribution across tissues to independent antibody HPA000243 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-OTC antibody HPA000570.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum using Anti-OTC antibody HPA000570.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-OTC antibody HPA000570.
- Sample type
- HUMAN