Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002786-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002786-M01, RRID:AB_425456
- Product name
- GNG4 monoclonal antibody (M01), clone 1D9-G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GNG4.
- Antigen sequence
MKEGMSNNSTASISQARKAVEQLKMEACMDRVKVS
QAAADLLAYCEAHVREDPLIIPVPASENPFREKKF
FCTIL- Isotype
- IgG
- Antibody clone number
- 1D9-G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GNG4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol