Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501931 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GAPDH antibody: synthetic peptide directed towards the N terminal of human GAPDH
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGN
PITIF QERDPSKIKW- Vial size
- 50 µg
Submitted references ABCA12 regulates ABCA1-dependent cholesterol efflux from macrophages and the development of atherosclerosis.
A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes.
Fu Y, Mukhamedova N, Ip S, D'Souza W, Henley KJ, DiTommaso T, Kesani R, Ditiatkovski M, Jones L, Lane RM, Jennings G, Smyth IM, Kile BT, Sviridov D
Cell metabolism 2013 Aug 6;18(2):225-38
Cell metabolism 2013 Aug 6;18(2):225-38
A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes.
Rinne T, Clements SE, Lamme E, Duijf PH, Bolat E, Meijer R, Scheffer H, Rosser E, Tan TY, McGrath JA, Schalkwijk J, Brunner HG, Zhou H, van Bokhoven H
Human molecular genetics 2008 Jul 1;17(13):1968-77
Human molecular genetics 2008 Jul 1;17(13):1968-77
No comments: Submit comment
No validations: Submit validation data