Explore
Validate
LearnH00008517-M02
antibody from Abnova Corporation
Targeting: IKBKG
FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008517-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008517-M02, RRID:AB_565865
- Product name
- IKBKG monoclonal antibody (M02), clone 1D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IKBKG.
- Antigen sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGK
PAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ
ILRERCEELLHFQASQREEKEFLMCKFQEARKLVE
RLGLE- Isotype
- IgG
- Antibody clone number
- 1D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IKBKG monoclonal antibody (M02), clone 1D4 Western Blot analysis of IKBKG expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged IKBKG is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to IKBKG on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
