HPA042559

antibody from Atlas Antibodies

Targeting: HDGFL2 Hdgfrp2, HRP2

Antibody data

Submit

Validation data

Product number: HPA042559 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042559, RRID:AB_2678049
Product name: Anti-CTB-50L17.10
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAK PVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKL HSEIKFALK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HDGFL2 protein structure - HPA042559 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, pancreas and testis using Anti-CTB-50L17.10 antibody HPA042559 (A) shows similar protein distribution across tissues to independent antibody HPA044208 (B).
Antibody #2 product nr: HPA044208
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach, upper shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CTB-50L17.10 antibody HPA042559.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-CTB-50L17.10 antibody HPA042559.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CTB-50L17.10 antibody HPA042559.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CTB-50L17.10 antibody HPA042559.
Sample type: HUMAN