Explore
Validate
LearnH00006500-M01
antibody from Abnova Corporation
Targeting: SKP1
EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006500-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006500-M01, RRID:AB_607028
- Product name
- SKP1A monoclonal antibody (M01), clone 1H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SKP1A.
- Antigen sequence
AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPV
WDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKT
VANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQ
FCL- Isotype
- IgG
- Antibody clone number
- 1H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SKP1A monoclonal antibody (M01), clone 1H8 Western Blot analysis of SKP1A expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SKP1 expression in transfected 293T cell line by SKP1A monoclonal antibody (M01), clone 1H8.Lane 1: SKP1 transfected lysate(18.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SKP1A on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
