Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405243 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lysine (K)-Specific Demethylase 6A (KDM6A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UTX antibody: synthetic peptide directed towards the middle region of human UTX
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQV
YDQFT LAPPLPSASS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.
Hong S, Cho YW, Yu LR, Yu H, Veenstra TD, Ge K
Proceedings of the National Academy of Sciences of the United States of America 2007 Nov 20;104(47):18439-44
Proceedings of the National Academy of Sciences of the United States of America 2007 Nov 20;104(47):18439-44
No comments: Submit comment
No validations: Submit validation data