Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005747-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005747-M03, RRID:AB_606878
- Product name
- PTK2 monoclonal antibody (M03), clone 1D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTK2.
- Antigen sequence
EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIY
PGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDL
RGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEER
FLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ- Isotype
- IgG
- Antibody clone number
- 1D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PTK2 monoclonal antibody (M03), clone 1D7 Western Blot analysis of PTK2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PTK2 monoclonal antibody (M03), clone 1D7. Western Blot analysis of PTK2 expression in Jurkat(Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PTK2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol